PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g014410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 464aa    MW: 52334.8 Da    PI: 6.5867
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g014410.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B361.61.3e-191692993
                    HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3  9 dvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93
                    + ++s+ l +p kf++eh + k+e+kt++l++  s r+Wevk+  + +    +lt+GWkeFv+a++L+ gD vvF+++g++ f  +
  Csa12g014410.1 16 NGFQSH-LKIPVKFFSEHIEAKHEGKTVKLQSdASKRTWEVKM--DDN----ILTEGWKEFVEAHDLRIGDLVVFRHEGDMFF--H 92
                    455555.9**********77778999*****97888*******..555....7***********************9987766..3 PP

2B375.27.3e-241482432100
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     f+++++ ++ ++++++lpk+fa+++g++k  + +++l++e+g+sWe k++ ++ sg++++ +GW + +++n+Lk+gD+++Fkl + +  ++v+++
  Csa12g014410.1 148 FSQTVTRSNISLNQVTLPKDFAKRNGLDKGMH-EIVLRNEEGKSWESKVK-SNMSGQVFICGGWTSLCSENKLKVGDSCTFKLLQ-NASTPVFQL 239
                     6788999*******************998765.****************5.66677789999********************999.56668***9 PP

                     E-SS CS
              B3  97 frks 100
                     +++s
  Csa12g014410.1 240 CSRS 243
                     9985 PP

3B341.13.1e-13264360199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     f++ + + ++l++g  +l k f ++++++k +  +++l+d++  +W +kl+++ ++ + ++ +  Wk+F+ an++ +g++++++l +  ++++++
  Csa12g014410.1 264 FVTLTPTQYSLENGKQYLGKCFSRANMLNKSG--KIILMDKDKVEWLMKLKVDSRGAMtIYGRHDWKSFCAANEVGAGESMTLELLR-GGTSPFL 355
                     556667889999***************99654..8***************8855554459999*********************987.7888999 PP

                     EEE-S CS
              B3  95 kvfrk 99 
                     k+++k
  Csa12g014410.1 356 KFCSK 360
                     99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.6E-234101IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.86E-215106IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.549799IPR003340B3 DNA binding domain
CDDcd100179.86E-19993No hitNo description
SMARTSM010191.3E-221099IPR003340B3 DNA binding domain
PfamPF023623.4E-141989IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.4E-25140241IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-22141240IPR015300DNA-binding pseudobarrel domain
CDDcd100173.15E-22147241No hitNo description
PROSITE profilePS5086314.819147243IPR003340B3 DNA binding domain
PfamPF023623.9E-23148242IPR003340B3 DNA binding domain
SMARTSM010191.2E-30148243IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.7E-14261360IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.33E-13263360IPR015300DNA-binding pseudobarrel domain
CDDcd100172.66E-10263359No hitNo description
PfamPF023629.7E-13264360IPR003340B3 DNA binding domain
PROSITE profilePS5086311.307264360IPR003340B3 DNA binding domain
SMARTSM010199.9E-20264361IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MANASTNQHF FQPLLNGFQS HLKIPVKFFS EHIEAKHEGK TVKLQSDASK RTWEVKMDDN  60
ILTEGWKEFV EAHDLRIGDL VVFRHEGDMF FHVIALGPHC CEIQYSQSTS HEEGEESDDI  120
EISPRPEKEV EENVQKESDQ SSSDLNCFSQ TVTRSNISLN QVTLPKDFAK RNGLDKGMHE  180
IVLRNEEGKS WESKVKSNMS GQVFICGGWT SLCSENKLKV GDSCTFKLLQ NASTPVFQLC  240
SRSKVDRKKK IRSADNNQTG ENLFVTLTPT QYSLENGKQY LGKCFSRANM LNKSGKIILM  300
DKDKVEWLMK LKVDSRGAMT IYGRHDWKSF CAANEVGAGE SMTLELLRGG TSPFLKFCSK  360
MAKPTFEAED GIRKKARIQN GEQETDKGEP SRESNKSSGN QGNVQQTQPC SVKDQVAKVK  420
ETVVDTLTSI RRFLTELETK EQELQDSLQD INKLERGEDN GNY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010447530.10.0PREDICTED: B3 domain-containing protein REM8-like
SwissprotQ8H2D10.0REM8_ARATH; B3 domain-containing protein REM8
TrEMBLR0GZI50.0R0GZI5_9BRAS; Uncharacterized protein
STRINGAT4G31680.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.10.0B3 family protein